Saltar al contenido
Merck
Todas las fotos(9)

Documentos clave

HPA008346

Sigma-Aldrich

ANTI-SUN1 antibody produced in rabbit

enhanced validation

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-Sad1/unc-84 protein-like 1, Anti-UNC84A, Anti-Unc-84 homolog A

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.43

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

validación mejorada

orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation

técnicas

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

secuencia del inmunógeno

QLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNS

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... UNC84A(23353)

¿Está buscando productos similares? Visita Guía de comparación de productos

Descripción general

Sad1 and UNC84 domain containing 1 (SUN1) is present in the inner nuclear envelope. It has a carboxyl-terminal domain called the SUN domain which is located in the space between the inner and outer nuclear membranes and an amino-terminal domain located in the nucleoplasm.
The SUN1 gene is localized on human chromosome 7p22.3. It is ubiquitously expressed and exists as 10 variants due to alternative splicing events.

Inmunógeno

Sad1/unc-84 protein-like 1 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-SUN1 antibody produced in rabbit has been used in immunoprecipitation.
Anti-SUN1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunocytochemistry (1 paper)
Immunohistochemistry (1 paper)
Western Blotting (1 paper)
These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Acciones bioquímicas o fisiológicas

Sad1 and UNC84 domain containing 1 (SUN1) plays an important role in linking telomeres with the nuclear envelope. It binds to telomere-binding proteins and helps in the formation of the meiotic bouquet. This is a special cluster formed by telomeres at the nuclear envelope and occurs before meiosis I. SUN1 also interacts with SUN2 to form heterodimers. This in turn helps in aiding the interaction between the nuclear envelope and the centrosome. It has also been shown that reforming nuclear envelope employs SUN1 to acetylate histones for de-condensation of DNA after mitosis. It is the one of the earliest factors to associate with segregated daughter chromosomes in anaphase.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST71108

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Monika Zwerger et al.
Molecular biology of the cell, 21(2), 354-368 (2009-11-27)
Lamin B receptor (LBR) is an inner nuclear membrane protein involved in tethering the nuclear lamina and the underlying chromatin to the nuclear envelope. In addition, LBR exhibits sterol reductase activity. Mutations in the LBR gene cause two different human
Jennifer M Bupp et al.
The Journal of cell biology, 179(5), 845-854 (2007-11-28)
Positioning of telomeres at the nuclear periphery can have dramatic effects on gene expression by establishment of heritable, transcriptionally repressive subdomains. However, little is known about the integral membrane proteins that mediate telomere tethering at the nuclear envelope. Here, we
Jennifer M Röhrl et al.
Cells, 10(1) (2021-01-21)
Hutchinson-Gilford progeria syndrome (HGPS) is a rare premature aging disease caused by a mutation in LMNA. A G608G mutation in exon 11 of LMNA is responsible for most HGPS cases, generating a truncated protein called "progerin". Progerin is permanently farnesylated
Ayaka Matsumoto et al.
Cancer medicine, 4(10), 1547-1557 (2015-07-16)
Cancer cells exhibit a variety of features indicative of atypical nuclei. However, the molecular mechanisms underlying these phenomena remain to be elucidated. The linker of nucleoskeleton and cytoskeleton (LINC) complex, a nuclear envelope protein complex consisting mainly of the SUN
Erina Satomi et al.
Genes to cells : devoted to molecular & cellular mechanisms, 25(11), 730-740 (2020-09-16)
The nucleolar structure is highly dynamic and strictly regulated in response to internal cues, such as metabolic rates, and to external cues, such as mechanical forces applied to cells. Although the multilayered nucleolar structure is largely determined by the liquid-like

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico