HPA002877

Anti-PGRMC1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-Membrane-associated progesterone receptor component 1 antibody produced in rabbit, Anti-mPR antibody produced in rabbit
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA002877
• NACRES: NA.43

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: mouse, rat, human
• enhanced validation: recombinant expression; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:500-1:1000
• immunogen sequence: DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR
• UniProt accession no.: O00264
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PGRMC1(10857)

Descripción

General description

Progesterone receptor membrane component 1/Sigma-2 receptor (PGRMC1) is a heme-binding protein involved in the activation of P450 proteins. PGRMC1 also binds plasminogen activator inhibitor RNA-binding protein-1 (PAIR-BP1). PGRMC1 is involved in the regulation of cancer cell survival or death following chemotherapy. PGRMC1-regulated gene expression is involved in progesterone inhibition of apoptosis.

Rabbit polyclonal anti-PGRMC1 antibody reacts with human membrane-associated progesterone receptor component 1.

Immunogen

Membrane-associated progesterone receptor component 1 recombinant protein epitope signature tag (PrEST)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunocytochemistry (1 paper)
Western Blotting (1 paper)

Rabbit polyclonal anti-PGRMC1 antibody is used to tag membrane-associated progesterone receptor component 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of membrane-associated progesterone receptor component 1 in the regulation of cell survival and apoptosis.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74350

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)