AV54329
Anti-IL4 antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-BSF1, Anti-IL-4, Anti-Interleukin 4, Anti-MGC79402
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Productos recomendados
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
15 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... IL4(3565)
Categorías relacionadas
Immunogen
Synthetic peptide directed towards the middle region of human IL4
Application
Anti-IL4 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
Interleukin-4 (IL-4) is a T cell derived chemokine that stimulates the Th2 mediated immune response and proliferation of B cells. The effects of IL-4 are mediated by two types of receptors, type I receptor consisting of IL-4Rα and common γ chain and type II receptor composed of IL-4Rα and IL-13Rα1. The signalling stimulated by IL-4 leads to activation of JAK/STAT6 and IRS-mediated PI3K/Akt pathway. Through these pathways, IL-4 is responsible for endocytic activity of macrophages, chemotaxis of leukocytes in response to inflammation, angiogenesis and regulation of nitric oxide metabolism in macrophages. Anti-tumor effects of IL-4 have been reported in cancers of breast, liver and renal cells.
Sequence
Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Michal Kuczma et al.
Journal of immunotoxicology, 11(4), 319-327 (2013-12-20)
Immunotherapy is becoming an increasingly attractive therapeutic alternative for conventional cancer therapy. In recent years Foxp3(+) regulatory T-cells (T(R)) were identified as the major obstacle to effective cancer immunotherapy. The abundance of these cells in peripheral blood is increased in
Kerstin Göbel et al.
European journal of immunology, 44(8), 2295-2305 (2014-05-09)
Lymphocyte adhesion and subsequent trafficking across endothelial barriers are essential steps in various immune-mediated disorders of the CNS, including MS. The molecular mechanisms underlying these processes, however, are still unknown. Phospholipase D1 (PLD1), an enzyme that generates phosphatidic acid through
C K Oh et al.
European respiratory review : an official journal of the European Respiratory Society, 19(115), 46-54 (2010-10-20)
Asthma is a complex, persistent, inflammatory disease characterised by airway hyperresponsiveness in association with airway inflammation. Studies suggest that regular use of high-dose inhaled corticosteroids and long-acting bronchodilators or omalizumab (a humanised monoclonal antibody that binds to immunoglobulin E and
Kerstin Wolk et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 20(21), 5507-5516 (2014-09-13)
Primary cutaneous T-cell lymphomas (CTCL) are neoplastic disorders of skin-homing T cells. Affected skin areas show morphologic similarities with alterations in other T-cell-mediated dermatoses. Furthermore, as in atopic dermatitis but in contrast with psoriasis, patients with CTCL are frequently afflicted
Hao-Wei Wang et al.
Cell cycle (Georgetown, Tex.), 9(24), 4824-4835 (2010-12-15)
Although macrophages were originally recognized as major immune effector cells, it is now appreciated that they also play many important roles in the maintenance of tissue homeostasis, and are involved in a variety of pathological conditions including cancer. Several studies
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico