AV48928

Anti-CXORF34 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-FLJ12687, Anti-dJ341D10.3
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 56 kDa
• species reactivity: dog, mouse, human, pig, horse, rabbit
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_079193
• UniProt accession no.: Q96GJ1
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CXorf34(79979)

Descripción

Immunogen

Synthetic peptide directed towards the middle region of human CXorf34

Application

Anti-CXORF34 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Biochem/physiol Actions

CXORF34 also known as tRNA methyltransferase 2 homolog B (TRMT2B) is an endo-exonuclease that is important for tRNA maturation and DNA double strand break repair.

Sequence

Synthetic peptide located within the following region: GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable