Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV46626

Sigma-Aldrich

Anti-RTN2 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-NSP2, Anti-NSPL1, Anti-Reticulon 2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

51 kDa

species reactivity

human, rat, pig, horse, mouse, bovine, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RTN2(6253)

Immunogen

Synthetic peptide directed towards the N terminal region of human RTN2

Application

Anti-RTN2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

Biochem/physiol Actions

RTN2 (reticulon 2) gene also referred to as NSP2 or NSPL1 is a member of reticulon encoding gene family. It plays a pivotal role in organizing endoplasmic reticulum and distal motor axons. RTN2B, isoform of RTN2 regulates the trafficking as well as facilitates as a positive modulator for delivering the EAAC1 (excitatory amino acid carrier 1) from ER to the cell surface. Mutation in RTN2 gene leads to axon-degenerative disorder hereditary spastic paraplegia type 12.

Sequence

Synthetic peptide located within the following region: MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Yiting Liu et al.
The Journal of biological chemistry, 283(10), 6561-6571 (2007-12-22)
Excitatory amino acid transporters (EAATs) are the primary regulators of extracellular glutamate concentrations in the central nervous system. Their dysfunction may contribute to several neurological diseases. To date, five distinct mammalian glutamate transporters have been cloned. In brain, EAAC1 (excitatory
Gladys Montenegro et al.
The Journal of clinical investigation, 122(2), 538-544 (2012-01-11)
Hereditary spastic paraplegias (HSPs) are a group of genetically heterogeneous neurodegenerative conditions. They are characterized by progressive spastic paralysis of the legs as a result of selective, length-dependent degeneration of the axons of the corticospinal tract. Mutations in 3 genes
Niamh C O'Sullivan et al.
Human molecular genetics, 21(15), 3356-3365 (2012-05-01)
Several causative genes for hereditary spastic paraplegia encode proteins with intramembrane hairpin loops that contribute to the curvature of the endoplasmic reticulum (ER), but the relevance of this function to axonal degeneration is not understood. One of these genes is

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico