Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

AV46350

Sigma-Aldrich

Anti-CDT1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Chromatin licensing and DNA replication factor 1, Anti-DUP, Anti-RIS2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

60 kDa

reactividad de especies

human, mouse, pig, rat

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CDT1(81620)

Inmunógeno

Synthetic peptide directed towards the C terminal region of human CDT1

Aplicación

Anti-CDT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.

Acciones bioquímicas o fisiológicas

CDT1 (chromatin licensing and DNA replication factor 1) gene also referred to as DUP or RIS2 encodes for a protein that is a nuclear localizing replication initiation factor and is expressed only during the G1 and S phases of the cell cycle. CDT1 interacts with CDC6 and stimulates the loading of the mini-chromosome maintenance complex onto chromatin. Hence it forms a pre-replication complex necessary to initiate DNA replication. Further, geminin inhibits CDT1 and may facilitate the inhibition of replication at inappropriate origins. Overexpression of Cdt1 mRNA and geminin may play a crucial role in pathogenesis of acute leukemia (AL).

Secuencia

Synthetic peptide located within the following region: PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Ke-Hua Zhang et al.
Zhongguo shi yan xue ye xue za zhi, 19(3), 578-581 (2011-07-07)
The purpose of this study was to detect the expression levels of geminin and cdt1 in peripheral blood and bone marrow from patients with newly diagnosed acute leukemia (AL), and further explore effects of them in the pathogenesis of AL.
Jeanette Gowen Cook et al.
The Journal of biological chemistry, 279(10), 9625-9633 (2003-12-16)
Chromosomal DNA replication requires the recruitment of the six-subunit minichromosome maintenance (Mcm) complex to chromatin through the action of Cdc6 and Cdt1. Although considerable work has described the functions of Cdc6 and Cdt1 in yeast and biochemical systems, evidence that
J A Wohlschlegel et al.
Science (New York, N.Y.), 290(5500), 2309-2312 (2000-12-23)
In all eukaryotic organisms, inappropriate firing of replication origins during the G2 phase of the cell cycle is suppressed by cyclin-dependent kinases. Multicellular eukaryotes contain a second putative inhibitor of re-replication called geminin. Geminin is believed to block binding of

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico