Skip to Content
Merck
All Photos(3)

Documents

SAB1409244

Sigma-Aldrich

Monoclonal Anti-IL8 antibody produced in mouse

clone 1B4, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1B4, monoclonal

form

buffered aqueous solution

mol wt

antigen 8.69 kDa

species reactivity

human

technique(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IL8(3576)

General description

The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. (provided by RefSeq)

Immunogen

IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein.

Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Biochem/physiol Actions

Interleukin-8 (IL-8) chemoattracts and activates neutrophils. It is involved in guiding neutrophils and oligodendrocytes to sites of infection. The protein also stimulates angiogenesis and tumor growth. It is also associated with inflammatory diseases.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Qi Sun et al.
International journal of clinical and experimental pathology, 8(7), 8376-8384 (2015-09-05)
Interleukin-8 (IL-8), matrix metalloproteinase-9 (MMP-9) and neovascularization have been implicated to be associated with biological processes, especially cancer progression. However, few studies have investigated the role of IL-8 in human hilar cholangiocarcinoma. In this study we detected the expression of
Prem Raj B Joseph et al.
The Biochemical journal, 472(1), 121-133 (2015-09-16)
Chemokine CXCL8/interleukin-8 (IL-8) plays a crucial role in directing neutrophils and oligodendrocytes to combat infection/injury and tumour cells in metastasis development. CXCL8 exists as monomers and dimers and interaction of both forms with glycosaminoglycans (GAGs) mediate these diverse cellular processes.
Label-free electrochemical impedance biosensor to detect human interleukin-8 in serum with sub-pg/ml sensitivity.
Sharma R
Biosensors And Bioelectronics, 80, 607-613 (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service