Skip to Content
Merck
All Photos(6)

Key Documents

HPA045153

Sigma-Aldrich

Anti-PRAME antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Prame Antibody, Prame Antibody - Anti-PRAME antibody produced in rabbit, Anti-Ct130, Anti-Mape, Anti-Preferentially expressed antigen in melanoma

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PRAME(23532)

General description

The gene PRAME (preferentially expressed antigen in melanoma) is mapped to human chromosome 22q11. The encoded protein belongs to the cancer D testis antigen family. It is a tumor-associated antigen. PRAME has very low or no expression in normal tissues.
PRAME protein interacts with:

Immunogen

preferentially expressed antigen in melanoma recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-PRAME antibody produced in rabbit has been used in western blotting, immunohistochemistry and immunofluorescence.

Biochem/physiol Actions

PRAME (preferentially expressed antigen in melanoma) is overexpressed in malignant cells, including primary and metastatic melanomas, acute and chronic leukaemias, Hodgkin′s lymphoma, breast cancer and head and neck squamous cell carcinomas. In AML (acute myeloid leukemia), high levels of PRAME are associated with lower relapse rate and high chances of disease-free survival. PRAME also plays a role in the retinol pathway. It modulates the metabolism of all-trans retinol (vitamin A) and its active metabolites, referred to as retinoids. It is a repressor of retinoic acid receptor signaling.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70289

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Elevated PRAME expression: what does this mean for treatment of head and neck squamous cell carcinoma?
Szczepanski MJ and Whiteside TL
Biomarkers in Medicine, 7, 575-578 (2013)
Y Xu et al.
European review for medical and pharmacological sciences, 20(6), 1057-1063 (2016-04-07)
PRAME (Preferentially Expressed Antigen in Melanoma) is a tumor-associated antigen recognized by immunocytes, and it induces cytotoxic T cell-mediated responses in melanoma. PRAME is expressed in a wide variety of tumors, but in contrast with most other tumor-associated antigens, it
PRAME expression and promoter hypomethylation in epithelial ovarian cancer.
Zhang W, et al.
Oncotarget, 7, 45352-45369 (2016)
The tumour antigen PRAME is a subunit of a Cul2 ubiquitin ligase and associates with active NFY promoters.
Costessi A, et al.
The Embo Journal, 30, 3786-3786 (2011)
PRAME Expression and Its Clinical Relevance in Hodgkin's Lymphoma.
Ercolak V, et al.
Acta Haematologica, 134, 199-207 (2015)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service