Skip to Content
Merck
All Photos(4)

Documents

HPA030180

Sigma-Aldrich

Anti-HOPX antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Hopx Antibody, Hopx Antibody - Anti-HOPX antibody produced in rabbit, Anti-HOP, Anti-HOP homeobox, Anti-LAGY, Anti-NECC1, Anti-OB1, Anti-SMAP31

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:2500- 1:5000

immunogen sequence

MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HOPX(84525)

General description

HOPX (homeodomain only protein x) gene is mapped in human chromosome 4q12. Unlike HOX proteins, it lacks a DNA-binding domain that is required for protein-DNA interactions. HOPX is widely expressed, but not in malignant tissues including choriocarcinoma, lung, uterine endometrial and gastrointestinal cancers. The gene contains 3 transcript variants HOPX- α, β, γ encoding the same protein.

Immunogen

HOP homeobox recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

HOPX (homeodomain only protein x) is involved in cardiac and skeletal muscle development by recruiting histone deacetylases. It controls the SRF (serum response factor)-dependent gene expression for the regulation of cardiac development. Downregulation of HOPX leads to cardiac hypertrophy in mice. In advanced human heart failure, HOPX expression is reduced. It acts as co-chaperone and organises the Hsp70-Hsp90 (heat shock proteins) proteins. It serves as a maker for a number of stem cell types. Studies show that HOPX inhibits tumour cell proliferation rate, migration and invasion in lung cancer. It also increase cell death by the activation of oncogenic Ras (GTPase) and the downstream MAPK (mitogen activated protein kinase) pathway.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST78383

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Homeobox gene HOP has a potential tumor suppressive activity in human lung cancer.
Chen Y
International Journal of Cancer. Journal International Du Cancer, 121(5), 1021-1027 (2007)
Cancer specific promoter CpG Islands hypermethylation of HOP homeobox (HOPX) gene and its potential tumor suppressive role in pancreatic carcinogenesis.
Waraya M
BMC Cancer, 12, 397-397 (2012)
Extracting a low-dimensional description of multiple gene expression datasets reveals a potential driver for tumor-associated stroma in ovarian cancer.
Celik S
Genome Medicine, 8(1), 66-66 (2016)
Association between non-coding polymorphisms of HOPX gene and syncope in hypertrophic cardiomyopathy.
Gulec C
Anadolu Kardiyoloji Dergisi : AKD = The Anatolian Journal of Cardiology, 14(7), 617-624 (2014)
Ziqi Zhao et al.
Cell research, 32(5), 425-436 (2022-03-12)
The differences in size and function between primate and rodent brains, and the association of disturbed excitatory/inhibitory balance with many neurodevelopmental disorders highlight the importance to study primate ganglionic eminences (GEs) development. Here we used single-cell RNA and ATAC sequencing

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service