SAB5702147

Anti-Glial Fibrillary Acidic Protein Antibody

rabbit monoclonal, 8M2F9

• Synonyme(s) : ALXDRD,GFAP
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• product name: Anti-GFAP Antibody, clone 8M2F9, Rabbit Monoclonal,
• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 8M2F9, monoclonal
• Forme: liquid
• Poids mol.: 48 kDa
• Espèces réactives: human, rat, rat
• Concentration: 0.50 mg/mL
• Technique(s): immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAE
• Numéro d'accès UniProt: P14136
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... GFAP(2670)

Description

Description générale

This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GFAP (P14136).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IHC, IF/ICC

Informations sur la sécurité

• Pictogrammes: GHS07,GHS09
• Mention d'avertissement: Warning
• Mentions de danger: H317,H411
• Conseils de prudence: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classification des risques: Aquatic Chronic 2 - Skin Sens. 1
• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3