SAB2104271
Anti-SPNS2, (N-terminal) antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-DFNB115, Anti-SLC62A2, Anti-SLC63A2
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
60 kDa
Espèces réactives
human, pig
Concentration
0.5 mg - 1 mg/mL
Technique(s)
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... SPNS2(124976)
Description générale
The sphingolipid transporter 2/Spinster 2 (SPNS2) gene codes for a transporter of the sphingosine-1-phosphate (S1P) signaling lipid. SPNS2 is a multi-pass transmembrane protein, that belongs to the spinster (SPNS)/major facilitator superfamily (MFS) family. It has 12 transmembrane domains. SPNS2 mRNA is seen abundantly in the lung, stomach, and placenta. It is expressed at a moderate level in the cervix, small intestine, brain, skin, lymph node, and other tissues.
Immunogène
Synthetic peptide directed towards the N terminal region of human SPNS2
Application
Anti-SPNS2, (N-terminal) antibody produced in rabbit has been used in immunoblotting (1:1000)/(1:3,000).
Actions biochimiques/physiologiques
The sphingolipid transporter 2/Spinster 2 (SPNS2) protein serves as a mediator to release intracellular sphingosine-1-phosphate (S1P) and thereby regulates S1P. It might play a role in embryogenesis. Members of MFS family regulates the homeostasis in the body by transporting sugars, amino acids, ions, intermediary metabolites, and other small molecules across membranes. Lack of SPNS2 results in a significant reduction in S1P plasma levels. It plays an important role in prostate cancer, inflammatory and autoimmune diseases, and liver fibrosis.
Séquence
Synthetic peptide located within the following region: PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
L Peltier et al.
Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA, 29(8), 1905-1915 (2018-05-04)
We aimed to study the mechanisms involved in bone-related iron impairment by using the osteoblast-like MG-63 cell line. Our results indicate that iron impact the S1P/S1PR signalizing axis and suggest that iron can affect the S1P process and favor the
Xiao Zhu et al.
Molecular immunology, 103, 55-62 (2018-09-10)
Sphingosine-1-phosphate (S1P), a bioactive metabolite of sphingolipid, has an important role in lymphocyte trafficking, immune responses, vascular and embryonic development, cancer, bone homeostasis, etc. S1P is produced intracellularly and then secreted into the circulation to engage in the above physiological
Grzegorz Młynarczyk et al.
Journal of cellular biochemistry, 123(4), 819-829 (2022-02-22)
There is a host of evidence for the role of bioactive sphingolipids in cancer biology, and dysregulated sphingolipid metabolism was observed in many malignant tumors. The aim of the present study was to provide more detailed data on sphingolipid metabolism
Isabelle Seidita et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 37(8), e23061-e23061 (2023-06-30)
Endometriosis is a chronic gynecological disease affecting ~10% women in the reproductive age characterized by the growth of endometrial glands and stroma outside the uterine cavity. The inflammatory process has a key role in the initiation and progression of the
Olivier Blanchard et al.
International journal of molecular sciences, 19(5) (2018-05-19)
Sphingosine kinase (SK) catalyses the formation of sphingosine 1-phosphate (S1P), which acts as a key regulator of inflammatory and fibrotic reactions, mainly via S1P receptor activation. Here, we show that in the human renal proximal tubular epithelial cell line HK2
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique