Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

SAB1407100

Sigma-Aldrich

Anti-DUSP14 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

MKP-L, MKP6

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~22.3 kDa

Espèces réactives

human

Technique(s)

indirect immunofluorescence: suitable
western blot: 1 μg/mL

Numéro d'accès NCBI

NM_007026.1

Numéro d'accès UniProt

O95147

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... DUSP14(11072)

Description générale

In addition to antigen recognition by the T-cell receptor, T-cell activation requires a second signal from a costimulatory receptor, such as CD28 (MIM 186760), which interacts with B7-1 (CD80; MIM 112203) and B7-2 (CD86; MIM 601020) ligands on antigen-presenting cells. CD28 costimulation induces transcription of interleukin-2 (IL2; MIM 147680) and stabilizes newly synthesized IL2 through the activation of mitogen-activated protein kinases (MAPKs), such as ERK (e.g., MAP2K4; MIM 601335) and JNK (see MIM 601158), and the subsequent creation of AP1 transcription factor (see MIM 165160). DUSP14 is a negative regulator of CD28 signaling.[supplied by OMIM

Immunogène

DUSP14 (NP_008957.1, 1 a.a. ~ 198 a.a) full-length human protein.

Sequence
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI

Application

Anti-DUSP14 antibody produced in mouse is suitable for indirect immunofluorescence and western blot assay.

Actions biochimiques/physiologiques

DUSP14 (Dual specificity phosphatase 14) is associated with several critical signaling pathways. It has ability to dephosphorylate both phosphotyrosine and phosphoserine/phosphothreonine residues on substrates. DUSP14 controls MAPK (mitogen-activated protein kinase) signaling pathway by dephosphorylating MAPK proteins ERK (extracellular-signal-regulated kinase), JNK (c-Jun N-terminal kinase) and p38. It has been reported that DUSP14 participates in T cell proliferation as a negative-feedback regulator.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Inhibition of Dual-specificity Phosphatase 14 (DUSP14) by PTP Inhibitor V.
Huiyun S and Sayeon C
Bull. Korean Chem. Soc., 34(12), 3871-3873 (2013)
Y Nakano
The British journal of dermatology, 156(5), 848-860 (2007-02-01)
Nonspecific unresponsive states of delayed-type hypersensitivity (DTH) to unrelated antigens are induced in mice by a single administration of hapten. In these studies, we found a unique regulatory mechanism of contact hypersensitivity (CHS) mediated by nonspecific suppressor factor (NSF) induced
Kate I Patterson et al.
The Biochemical journal, 418(3), 475-489 (2009-02-21)
DUSPs (dual-specificity phosphatases) are a heterogeneous group of protein phosphatases that can dephosphorylate both phosphotyrosine and phosphoserine/phosphothreonine residues within the one substrate. DUSPs have been implicated as major modulators of critical signalling pathways that are dysregulated in various diseases. DUSPs
Yanfang Li et al.
Cardiovascular engineering and technology, 11(2), 219-227 (2020-01-10)
Recent studies have demonstrated that miRNAs play a vital role in regulating myocardial ischemia/reperfusion injury (MIRI). MiR-217 has been proven to be implicated in cardiac diseases such as chronic heart failure and cardiac myxoma. However, the role of miR-217 in

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique