Accéder au contenu
Merck
Toutes les photos(2)

Documents

MSQC18

Sigma-Aldrich

SILu™Lite SigmaMAb Cetuximab Monoclonal Antibody

recombinant, expressed in CHO cells

Synonyme(s) :

Mass spectrometry standard, Cetuximab

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
41105331
Nomenclature NACRES :
NA.41

Produit recombinant

expressed in CHO cells

Pureté

≥90% (SDS-PAGE)

Forme

solid

Adéquation

suitable for mass spectrometry

Conditions d'expédition

wet ice

Température de stockage

−20°C

Description générale

SigmaMAb Cetuximab (MSQC18) was designed to be a standard for the analysis of Cetuximab monoclonal antibodies using mass spectrometry. An isotopically labeled version is available as SILu™Mab Cetuximab (MSQC19).

SigmaMAb Cetuximab is for R&D use only. Not for drug, household, or other uses.

Application

SILu™ Lite SigmaMAb Cetuximab Monoclonal Antibody has been used in isoluminol enhanced chemiluminescence assay to measure the reactive oxygen species (ROS) production from monocytes.

Séquence

SigmaMab Cetuximab Heavy Chain:
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SigmaMab Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Informations légales

SILu is a trademark of Sigma-Aldrich Co. LLC

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Sachin Surve et al.
The Journal of cell biology, 220(11) (2021-09-14)
The subcellular localization of RAS GTPases defines the operational compartment of the EGFR-ERK1/2 signaling pathway within cells. Hence, we used live-cell imaging to demonstrate that endogenous KRAS and NRAS tagged with mNeonGreen are predominantly localized to the plasma membrane. NRAS
Ali A Akhiani et al.
Cancer immunology research, 8(12), 1532-1541 (2020-09-25)
The phosphatidylinositol-4,5-bisphosphate-3 kinase-δ (PI3Kδ) inhibitor idelalisib, used alone or in combination with anti-CD20, is clinically efficacious in B-cell lymphoma and chronic lymphocytic leukemia (CLL) by promoting apoptosis of malignant B cells. PI3K regulates the formation of reactive oxygen species (ROS)

Articles

Monoclonal Antibody Titer Determination Using a Chromolith® WP 300 Protein A Wide Pore Monolithic Silica HPLC Column

Method development for titer determination of three different monoclonal antibodies - cetuximab, trastuzumab, and universal antibody standard using a Chromolith® WP 300 Protein A column.

Monoclonal Antibody Titer Determination Using a Chromolith® WP 300 Protein A Wide Pore Monolithic Silica HPLC Column

Method development for titer determination of three different monoclonal antibodies - cetuximab, trastuzumab, and universal antibody standard using a Chromolith® WP 300 Protein A column.

Monoclonal Antibody Titer Determination Using a Chromolith® WP 300 Protein A Wide Pore Monolithic Silica HPLC Column

Method development for titer determination of three different monoclonal antibodies - cetuximab, trastuzumab, and universal antibody standard using a Chromolith® WP 300 Protein A column.

Monoclonal Antibody Titer Determination Using a Chromolith® WP 300 Protein A Wide Pore Monolithic Silica HPLC Column

Method development for titer determination of three different monoclonal antibodies - cetuximab, trastuzumab, and universal antibody standard using a Chromolith® WP 300 Protein A column.

Afficher tout

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique