HPA035832

Anti-CD33 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-FLJ00391, Anti-SIGLEC-3, Anti-SIGLEC3, Anti-p67
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA035832
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunohistochemistry: 1:200-1:500
• Séquence immunogène: KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ
• Numéro d'accès UniProt: P20138
• Application(s): research pathology
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CD33(945)

Description

Description générale

Myeloid cell surface antigen CD33 (cluster of differentiation 33), also known as SIGLEC3 (sialic acid binding Ig-like lectins) and GP67, belongs to the CD33-related SIGLEC gene family. It is a type 1 transmembrane protein and has two immunoglobulin-like extracellular domains, a single transmembrane area and two intracellular inhibitory motifs. The CD33 gene is located on human chromosome 19q13.

Immunogène

CD33 molecule

Application

Anti-CD33 antibody has been used in immunohistochemical staining.

Actions biochimiques/physiologiques

CD33 (cluster of differentiation 33) is mainly involved in anti-inflammatory signaling, cell adhesion and endocytosis functions. CD33 serves as a myeloid differentiation marker. Mutations in the CD33 gene are associated with Alzheimer′s disease susceptibility and acute myeloid leukemia treatment efficacy.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71736

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable