HPA007308

Anti-NQO1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-Azoreductase antibody produced in rabbit, Anti-DT-diaphorase antibody produced in rabbit, Anti-DTD antibody produced in rabbit, Anti-Menadione reductase antibody produced in rabbit, Anti-NAD(P)H dehydrogenase [quinone] 1 antibody produced in rabbit, Anti-NAD(P)H:quinone oxidoreductase 1 antibody produced in rabbit, Anti-Phylloquinone reductase antibody produced in rabbit, Anti-QR1 antibody produced in rabbit, Anti-Quinone reductase 1 antibody produced in rabbit
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA007308
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Séquence immunogène: FRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR
• Numéro d'accès UniProt: P15559
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... NQO1(1728)

Description

Description générale

NAD(P)H:quinone oxidoreductase 1 is a homodimer that is predominantly cytosolic. Each monomer contains one molecule of FAD. The gene is localized to human chromosome 16q22.1 and is a single copy gene. It consists of six exons interspaced by five introns and spans a length of 20kb. The 5′UT, first two amino acids, and the first nucleotide of the third amino acid are encoded by exon 1. The rest of the exons encode the remaining 272 amino acids and the 3′UT.

Immunogène

NAD(P)H dehydrogenase [quinone] 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-NQO1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

NQO1 (NAD(P)H:quinone oxidoreductase 1) gene encodes an obligate two-electron reductase that utilizes either NADH or NADPH as a reducing cofactor. It catalyzes reduction of substrates such as quinones, quinone-imines, glutathionyl-substituted naphthoquinones, dichlorophenolindolphenol, methylene blue, azo and nitro compounds, dinitropyrenes, nitrophenylaziridines and nitrobenzamides. It also catalyzes four-electron reduction of azo dyes and nitro compounds. It functions in the detoxification of redox-cycling quinones such as menadione. It also plays the role of an antioxidant by regenerating antioxidant forms of ubiquinone and Vitamin E. By catalyzing these reactions, it protects cells from oxidant stress and electrophilic attack. Defects in this gene have been associated with tardive dyskinesia (TD) and an increased risk of hematotological malignancy after exposure to benzene. Polymorphism in this gene also increases the susceptibility to various cancers

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST70184

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)