Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV47036

Sigma-Aldrich

Anti-TOR1B antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-DQ1, Anti-MGC4386, Anti-Torsin family 1, member B (torsin B)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

38 kDa

Espèces réactives

rat, mouse, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... TOR1B(27348)

Immunogène

Synthetic peptide directed towards the C terminal region of human TOR1B

Application

Anti-TOR1B antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.

Actions biochimiques/physiologiques

TOR1B [Torsin family 1, member B (torsin B)] gene encodes a 336 amino acid containing protein, predominantly expressed in the developing human brain and belonging to ClpA/ClpB family and torsin subfamily. It plays a pivotal role in postnatal developmental events and is crucial for proper neurological development. TOR1B may also facilitate as a molecular chaperone assisting in the proper folding of secreted and membrane proteins. Mutation in TOR1B gene results in torsion dystonia, an autosomal dominant neurological disorder.

Séquence

Synthetic peptide located within the following region: VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

E Bahn et al.
Brain research, 1116(1), 112-119 (2006-08-30)
Familial, early onset, generalized torsion dystonia is the most common and severe primary dystonia. The majority of cases are caused by a 3-bp deletion (GAG) in the coding region of the DYT1 (TOR1A) gene. The cellular and regional distribution of
Anju Vasudevan et al.
Brain research, 1073-1074, 139-145 (2006-02-07)
Early onset torsion dystonia is characterized by involuntary movements and distorted postures and is usually caused by a 3-bp (GAG) deletion in the DYT1 (TOR1A) gene. DYT1 codes for torsinA, a member of the AAA+ family of proteins, implicated in
C Kamm et al.
Neurology, 67(10), 1857-1859 (2006-11-30)
Recently, association of a TOR1A(DYT1)/TOR1B risk haplotype with common forms of idiopathic dystonia has been reported in the Icelandic population. Here we report a strong association of two single nucleotide polymorphisms within or in close proximity to the TOR1A 3'UTR

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique