AV43905
Anti-SLC20A1 antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-DKFZp686J2397, Anti-FLJ41426, Anti-GLVR1, Anti-Glvr-1, Anti-PIT1, Anti-PiT-1, Anti-Solute carrier family 20 (phosphate transporter), member 1
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
74 kDa
Espèces réactives
pig, dog, horse, bovine, human
Concentration
0.5 mg - 1 mg/mL
Technique(s)
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... SLC20A1(6574)
Catégories apparentées
Description générale
Sodium-dependent phosphate transporter 1 (SLC20A1) protein is an inorganic phosphate transporter and a sodium-phosphate symporter. It is expressed in the plasma membrane and belongs to the inorganic phosphate transporter family (PiT). Also called PIT1, it is an N-linked glycosylated protein with N and C termini placed in the extracellular region. It comprises 12 transmembrane domains. SLC20A1 gene is mapped to human chromosome 2q14.1.
Spécificité
Anti-SLC20A1 polyclonal antibody reacts with canine and human solute carrier family 20 (phosphate transporter) member 1 proteins.
Immunogène
Synthetic peptide directed towards the C terminal region of human SLC20A1
Application
Anti-SLC20A1 antibody produced in rabbit has been used in western blotting (1:1000).
Actions biochimiques/physiologiques
Sodium-dependent phosphate transporter 1 (SLC20A1) protein is a high-affinity sodium (Na+)-phosphate (Pi) co-transporter that imports inorganic phosphate (Pi). It serves as a receptor for gibbon ape leukemia virus (GALV), feline leukemia virus type B (FeLV-B), woolly monkey virus and 10A1 murine leukemia virus, making it crucial for viral entry. SLC20A1 is essential for urinary tract and urorectal development. Variants ofSLC20A1 gene are implicated in the pathophysiology of bladder exstrophy-epispadias complex (BEEC) and in cloacal exstrophy. It may also participate in normal growth and development of the liver. Elevated expression of SLC20A1 gene is correlated to the activation of the wingless (Wnt)/β-catenin signaling pathway in somatotroph adenomas. SLC20A1 protein may participate in tumor necrosis factor-induced apoptosis and regulate cell proliferation, erythroid and B cell differentiation.
Séquence
Synthetic peptide located within the following region: LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Mengqi Chang et al.
Frontiers in endocrinology, 11, 596554-596554 (2021-02-13)
Pituitary adenomas (PAs) can be classified as non-secreting adenomas, somatotroph adenomas, corticotroph adenomas, lactotroph adenomas, and thyrotroph adenomas. Substantial advances have been made in our knowledge of the pathobiology of PAs. To obtain a comprehensive understanding of the molecular biological
Eugénie Koumakis et al.
Scientific reports, 9(1), 1808-1808 (2019-02-14)
PiT1/SLC20A1 is an inorganic phosphate transporter with additional functions including the regulation of TNFα-induced apoptosis, erythropoiesis, cell proliferation and insulin signaling. Recent data suggest a relationship between PiT1 and NF-κB-dependent inflammation: (i) Pit1 mRNA is up-regulated in the context of
Laurent Beck et al.
PloS one, 5(2), e9148-e9148 (2010-02-18)
PiT1 (or SLC20a1) encodes a widely expressed plasma membrane protein functioning as a high-affinity Na(+)-phosphate (Pi) cotransporter. As such, PiT1 is often considered as a ubiquitous supplier of Pi for cellular needs regardless of the lack of experimental data. Although
Karen B Farrell et al.
Journal of virology, 76(15), 7683-7693 (2002-07-05)
The mammalian gammaretroviruses gibbon ape leukemia virus (GALV) and feline leukemia virus subgroup B (FeLV-B) can use the same receptor, Pit1, to infect human cells. A highly polymorphic nine-residue sequence within Pit1, designated region A, has been proposed as the
Johanna Magdalena Rieke et al.
Frontiers in cell and developmental biology, 8, 567-567 (2020-08-28)
Previous studies in developing Xenopus and zebrafish reported that the phosphate transporter slc20a1a is expressed in pronephric kidneys. The recent identification of SLC20A1 as a monoallelic candidate gene for cloacal exstrophy further suggests its involvement in the urinary tract and
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique