AV33402

Anti-TBX5 (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-T-box 5
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 39 kDa
• Espèces réactives: human, guinea pig, rabbit, bovine, dog, rat
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_000183
• Numéro d'accès UniProt: Q99593-2
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TBX5(6910)

Description

Description générale

T-box genes encode transcription factors that regulate developmental processes. T-box transcription factor 5 (TBX5), a transcription factor expressed in the prospective hindlimb and forelimb territories and in a subpopulation of endocardial cells, is involved in the regulation of the specification of upper limb identity and heart development during embryogenesis. Defective TBX5 is linked with Holt-Oram syndrome, a condition associated with bone defects in the upper arms, wrists and/or hands and congenital heart defects.

Spécificité

Rabbit polyclonal anti-TBX5 antibody reacts with canine, rat, chicken, human, and mouse T-box transcription factor 5 transcription factors.

Immunogène

Synthetic peptide directed towards the middle region of human TBX5

Application

Rabbit polyclonal anti-TBX5 antibody is used to tag T-box 5 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of T-box transcription factor 5 in the specification of upper limb identity and heart development during embryogenesis.

Actions biochimiques/physiologiques

TBX5 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs.

Séquence

Synthetic peptide located within the following region: RMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable