AV31264

Anti-CREB1 antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-CREB, Anti-MGC9284, Anti-cAMP responsive element binding protein 1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 37 kDa
• Espèces réactives: mouse, horse, rabbit, rat, dog, human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_004370
• Numéro d'accès UniProt: P16220
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CREB1(1385)

Description

Description générale

CREB1 is a leucine zipper transcription factor that interacts with cAMP-responsive element. Rabbit Anti-CREB1 antibody recognizes human, mouse, rat, bovine, and canine CREB1.

Immunogène

Synthetic peptide directed towards the N terminal region of human CREB1

Application

Rabbit Anti-CREB1 antibody is suitable for use in western blot applications at 1.25μg/ml.

Actions biochimiques/physiologiques

CREB1 is a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway.This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in two transcript variants encoding different isoforms.

Séquence

Synthetic peptide located within the following region: QVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQES

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable