AG549

α-synuclein 61-140, human

• Code UNSPSC : 12352203
• eCl@ss : 32160702
• Nomenclature NACRES : NA.77

Propriétés

• Source biologique: human
• Niveau de qualité: 100
• Pureté: >95% (SDS-PAGE)
• Forme: powder
• Poids mol.: M_w 8,460 Da
• Fabricant/nom de marque: Chemicon^®
• Technique(s): cell based assay: suitable
• Numéro d'accès NCBI: NM_000345.2; NM_007308.1
• Numéro d'accès UniProt: P37840
• Conditions d'expédition: dry ice
• Informations sur le gène: human ... SNCA(6622)

Description

Description générale

Alpha-synuclein is encoded by the SNCA gene (also known as NACP, PARK1) in human. There are two other known synuclein family members, beta- and gamma-synuclein. Interest in synuclein research started with the discovery of alpha-synuclein mutation in several families with autosomal dominant Parkinson′s disease (PD). Alpha-synuclein is abundantly expressed in the brain and is found in a classic amyloid fibril form within the intra-neuronal Lewy body deposits of PD. The physiological function of synucleins is not well understood, but appears to involve membrane interactions, and in particular reversible binding to synaptic vesicle membranes. Contradictory evidences regarding inhibitory action of alpha-synuclein against phospholipase D (PLD) have been reported (PMID 11821392 & 19146388). Clone Syn211, Cat. No. 36-008-C detects epitope in the region from amino acid 121 to 125 and has been used together with clone LB509, Cat. No. MABN824, to characterize the digestion pattern of different forms of in vitro prepared alpha-synclulein aggregates (Guo, J.L., et al. 2013; PMID 23827677).

MEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEE-
GAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
An additional amino acid (Met) is attached at the N-terminus.

Product Source: E. coli

Application

Research Category
Neuroscience

Research Sub Category
Neurodegenerative Diseases

Forme physique

White lyophilized powder. Resuspend in sterile water at concentration of 1 mg/mL. This will give you a final of 20 mM Tris/HCI, pH 7.5, 100 mM NaCl.

Stockage et stabilité

Maintain lyophilized material at -20°C for up to 12 months after date of receipt. After reconstitution maintain at -20°C to -70°C for up to 2 weeks in undiluted aliquots. Avoid freeze/thaw cycles to avoid aggregation.

Informations légales

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 11 - Combustible Solids
• Classe de danger pour l'eau (WGK): WGK 1