AV45760

Anti-PDE9A antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-HSPDE9A2, Anti-Phosphodiesterase 9A
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 61 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_002597
• UniProt accession no.: O76083-13
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PDE9A(5152)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human PDE9A

Biochem/physiol Actions

Phosphodiesterase 9A (PDE9A) is a high-affinity, cGMP-specific enzyme. It belongs to an important protein family that catalyzes the hydrolysis of cyclic nucleotide monophosphates (cAMP and cGMP). The members of this family are also secondary intracellular messengers responsible for transducing a variety of extra-cellular signals.

Sequence

Synthetic peptide located within the following region: SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable