WH0387129M1

Monoclonal Anti-GPR154 antibody produced in mouse

clone 2F5, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-G protein-coupled receptor 154, Anti-GPRA, Anti-PGR14, Anti-VRR1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2F5, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso Genebanck: NM_207173
• N° accesso UniProt: Q6W5P4
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... NPSR1(387129)

Descrizione

Descrizione generale

This gene is a member of the G protein-coupled receptor 1 family and encodes a plasma membrane protein. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Mutations in this gene have also been associated with this disease. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. (provided by RefSeq)

Immunogeno

GPR154 (NP_997056, 2 a.a. ~ 53 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL

Azioni biochim/fisiol

G protein-coupled receptor 154 (GPR154) is involved in processes like nociception and inflammation. Polymorphisms in the gene encoding it are linked to asthma and chronic inflammatory diseases.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)