Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

WH0057526M4

Sigma-Aldrich

Monoclonal Anti-PCDH19 antibody produced in mouse

clone 2G10, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-DKFZp686P1843, Anti-KIAA1313, Anti-protocadherin 19

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.43

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

2G10, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PCDH19(57526)

Categorie correlate

Descrizione generale

Protocadherin 19 (PCDH19) is part of the d-protocadherin superfamily. It is expressed in the brain. The gene encoding this calcium-dependent cell adhesion protein is localized on human chromosome Xq22.1.

Immunogeno

PCDH19 (NP_065817, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQPDLIINGAPLPETENYSFDSNYVNSR

Azioni biochim/fisiol

Protocadherin 19 (PCDH19) has been associated with female-specific epilepsy and an X-linked model of neurological disease. It has a role in neuronal organization and migration. PCDH19 is also involved in cell-cell and cell-matrix adhesion.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

nwg

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

The clinical spectrum of female epilepsy patients with PCDH19 mutations in a Chinese population
A. Liu
Clinical Genetics, 91(1) (2017)
Male patients affected by mosaic PCDH19 mutations: five new cases
I.M. de Lange
Neurogenetics (2017)
Characterizing PCDH19 in human induced pluripotent stem cells (iPSCs) and iPSC-derived developing neurons: emerging role of a protein involved in controlling polarity during neurogenesis
Claudia Compagnucci
Oncotarget, 6(29), 26804-26813 (2015)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.