WH0051428M1

Monoclonal Anti-DDX41 antibody produced in mouse

clone 2F4, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-ABS, Anti-DEAD (Asp-Glu-Ala-Asp) box polypeptide 41, Anti-MGC8828
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2F4, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso Genebanck: NM_016222
• N° accesso UniProt: Q9UJV9
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... DDX41(51428)

Descrizione

Descrizione generale

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Based on studies in Drosophila, the abstrakt gene is widely required during post-transcriptional gene expression. (provided by RefSeq)

Immunogeno

DDX41 (NP_057306, 523 a.a. ~ 622 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF

Caratteristiche e vantaggi

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)