WH0023404M6

Monoclonal Anti-EXOSC2 antibody produced in mouse

clone 4B6, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-RRP4, Anti-Rrp4p, Anti-exosome component 2, Anti-hRrp4p, Anti-p7
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 4B6, monoclonal
• Stato: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable
• Isotipo: IgG2aκ
• N° accesso Genebanck: NM_014285
• N° accesso UniProt: Q13868
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... EXOSC2(23404)

Descrizione

Descrizione generale

EXOSC2 (Exosome component 2) is a non-catalytic subunit of the eukaryotic RNA exosome. It is localized in the nucleus and in the cytoplasm.

Immunogeno

EXOSC2 (NP_055100, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRS

Azioni biochim/fisiol

EXOSC2 (Exosome component 2) is associated with several cellular processes such as rRNA processing, RNA degradation from the 3′ end, 3′ to 5′ decay of the mRNA body after its deadenylation. Exosome complex is an ~400kDa multimeric complex, which plays a vital role in substrate recognition. EXOSC2 functions as a cofactor in the maintenance of human exosome integrity and efficient degradation and/or metabolism of various RNA classes.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)