WH0007267M9

Monoclonal Anti-TTC3 antibody produced in mouse

clone 2D10, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-DCRR1, Anti-DKFZp686M0150, Anti-RNF105, Anti-TPRDIII, Anti-tetratricopeptide repeat domain 3
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2D10, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable
• Isotipo: IgG2aκ
• N° accesso Genebanck: NM_003316
• N° accesso UniProt: P53804
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TTC3(7267)

Descrizione

Descrizione generale

TTCR (tetratricopeptide repeat protein 3) is one of the main genes present within the Down syndrome critical region (DSCR) on human chromosome 21q22.2. The encoded protein is an E3 ubiquitin liase, composed of 2025 amino acids, and its N-terminal contains three tetratricopeptide repeat (TPR) motifs. It also contains a RING (really interesting new gene) finger motif, a putative Akt phosphorylation site, and nuclear localization signals.

Immunogeno

TTC3 (NP_003307, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MDNFAEGDFTVADYALLEDCPHVDDCVFAAEFMSNDYVRVTQLYCDGVGVQYKDYIQSERNLEFDICSIWCSKPISVLQDYCDAIKINIFWPLLFQHQNSSVISRLHPCV

Azioni biochim/fisiol

TTCR (tetratricopeptide repeat protein 3) interacts with phosphorylated Akt protein, and promotes its ubiquitination and degradation in the nucleus. The expression of TTCR is increased in Down syndrome (DS) cells, and its interaction with Akt protein is thought to be responsible for the clinical symptoms of DS. TTC3-RhoA-CIT-K (citron kinase) pathway is thought to play a key role in neuronal development, and its hyperactivity might result in disruption of normal differentiation.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)