SAB5702759

Anti-ARF1 Antibody, clone 0C5B3, Rabbit Monoclonal

• Sinonimo/i: ARF1, ADP-ribosylation factor 1
• Codice UNSPSC: 12352203
• NACRES: NA.46

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 0C5B3, monoclonal
• Forma fisica: liquid
• PM: 19 kDa
• Reattività contro le specie: rat, human, rat
• Concentrazione: 0.30 mg/mL
• tecniche: immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: GQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRH
• N° accesso UniProt: P84077
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ARF1(375)

Descrizione

Descrizione generale

ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 70-150 of human ARF1 (P84077).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Applicazioni

WB, IF/ICC

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1