SAB2109072

Anti-IL22RA1 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: CRF2-9, IL22R, IL22R1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 63 kDa
• Reattività contro le specie (prevista in base all’omologia): rabbit, horse, human, rat, guinea pig, canine, mouse, pig
• Concentrazione: 0.5 mg/mL
• tecniche: western blot: 1 μg/mL
• N° accesso NCBI: NM_021258
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... IL22RA1(57396)

Descrizione

Descrizione generale

IL22RA1 belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4), a subunit also shar

Immunogeno

Synthetic peptide directed towards the middle region of human IL22RA1

Sequenza

Synthetic peptide located within the following region: YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ

Stato fisico

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable