SAB2108448
Anti-PCNA
IgG fraction of antiserum
Sinonimo/i:
Anti-AIT
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Scegli un formato
100 μL
CHF 417.00
CHF 417.00
Check Cart for Availability
Scegli un formato
Cambia visualizzazione
100 μL
CHF 417.00
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
CHF 417.00
Check Cart for Availability
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
IgG fraction of antiserum
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Stato
buffered aqueous solution
PM
29 kDa
Reattività contro le specie
bovine, rat, dog, mouse, human
Concentrazione
0.5-1 mg/mL
tecniche
immunoblotting: suitable
immunohistochemistry: suitable
Numero d’accesso
NM_002592
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... PCNA(5111)
Descrizione generale
Proliferating cell nuclear antigen (PCNA), a nuclear protein, is expressed ubiquitously in mammals. This homotrimer protein is a doughnut-shaped molecule that is expressed at high levels in the thymus, bone marrow, fetal liver, and few cells of the small intestine and colon. PCNA is mainly located in the nucleus. The PCNA gene is a single-copy gene mapped to human chromosome 20p13.
Immunogeno
Synthetic peptide directed towards the C terminal region of human PCNA
Applicazioni
Azioni biochim/fisiol
Proliferating cell nuclear antigen (PCNA) participates in DNA replication and repair. It acts as an auxiliary factor of polymerase δ. It plays a key role in the maturation of Okazaki fragments. It can be used as a prognostic and diagnostic marker in chronic lymphoid leukemia (CLL). High expression of PCNA protein is seen in breast and duodenal cancers.
Sequenza
Synthetic peptide located within the following region: LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Weixin Hou et al.
Journal of inflammation research, 14, 7295-7313 (2022-01-08)
Acute-on-chronic liver failure (ACLF) is a critical disease with a high fatality rate. Immune dysfunction and inflammatory responses are key risk factors in ACLF. Pyroptosis is a form of programmed cell death characterized by the release of inflammatory cytokines, which
Farida E Elbassiouni et al.
Nanomaterials (Basel, Switzerland), 12(3) (2022-02-16)
Colorectal cancer is the third most common cancer. Because curcumin (CUR) has anti-inflammatory and anticancer properties, research has been undertaken to indicate that nanocurcumin compounds can be used to treat a variety of cancers. CUR in nanoform has been found
Michael J Bertoldo et al.
Reproduction (Cambridge, England), 161(2), 215-226 (2020-12-16)
Ovarian tissue cryopreservation and future transplantation is the only strategy to preserve the fertility of young female adolescent and prepubertal patients. The primary challenge to ovarian graft longevity is the substantial loss of primordial follicles during the period of ischaemia
Qianling Ye et al.
Scientific reports, 14(1), 392-392 (2024-01-04)
The pathogenesis of Acute-on-chronic liver failure (ACLF) involves several forms of cell death, such as pyroptosis, apoptosis, and necroptosis, which consist of PANoptosis. To explore PANoptosis as a regulated cell death pathway in ACLF. Firstly, a bioinformatic strategy was used
Elsayed I Salim et al.
Asian Pacific journal of cancer prevention : APJCP, 21(9), 2739-2750 (2020-09-29)
In search for a unique natural combination of highly active biological components for treatment against colon cancer, we used aqueous extract of Ascidia, Styela plicata (ASCex), a marine invertebrate depending on its richness of high levels of biologically active components
Active Filters
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.
