The immunogen for this product is HYYSVRDTLLGPGR. Which for this sequence it is only partially covered by the preferred immunogen sequence.
SAB2106702
Anti-DCT antibody produced in rabbit
affinity isolated antibody
Sinonimo/i:
Anti-OCA8, Anti-TRP-2, Anti-TYRP2
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Scegli un formato
100 μL
CHF 465.00
CHF 465.00
Spedizione prevista il30 maggio 2025
Scegli un formato
Cambia visualizzazione
100 μL
CHF 465.00
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
CHF 465.00
Spedizione prevista il30 maggio 2025
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Stato
buffered aqueous solution
PM
56 kDa
Reattività contro le specie
rat, horse, dog, rabbit, human, guinea pig, bovine, mouse, sheep
Concentrazione
0.5 mg - 1 mg/mL
tecniche
immunohistochemistry: suitable
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... DCT(1638)
mouse ... Dct(13190)
Descrizione generale
The previously assigned protein identifier Q6NXI2 has been merged into P29812. Full details can be found on the UniProt database.
Immunogeno
Synthetic peptide directed towards the middle region of human DCT
Sequenza
Synthetic peptide located within the following region: QHWLGLLGPNGTQPQIANCSVYDFFVWLHYYSVRDTLLGPGRPYKAIDFS
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
-
I'm looking for an Ab against the peptide "SVYDFFVWLHYYSV". May I ask if the immunogen to raise this Ab (SAB2106702) contain the entire region of it? If not, is it partially included?
1 answer-
Helpful?
-
Active Filters
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.
