Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

SAB2106426

Sigma-Aldrich

Anti-IGHMBP2 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-CATF1, Anti-CMT2S, Anti-HCSA, Anti-HMN6, Anti-SMARD1, Anti-SMUBP2, Anti-ZFAND7

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 466.00

CHF 466.00


Check Cart for Availability


Scegli un formato

Cambia visualizzazione
100 μL
CHF 466.00

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

CHF 466.00


Check Cart for Availability

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

109 kDa

Reattività contro le specie

bovine, mouse, guinea pig, human, dog, rat

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... IGHMBP2(3508)
mouse ... Ighmbp2(20589)

Immunogeno

Synthetic peptide directed towards the N terminal of human IGHMBP2

Azioni biochim/fisiol

Ighmbp2 is a 5′ to 3′ helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Ighmbp2 acts as a transcription regulator. Ighmbp2 is required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Ighmbp2 exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Ighmbp2 binds to the insulin II gene RIPE3B enhancer region. Ighmbp2 may be involved in translation.Ighmbp2 is a DNA-binding protein specific to 5′-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region.Ighmbp2 preferentially binds to the 5′-GGGCT-3′ motif. Ighmbp2 interacts with tRNA-Tyr.

Sequenza

Synthetic peptide located within the following region: QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

148th Annual Meeting American Neurological Association.
Annals of neurology, 94 Suppl 30, S1-S303 (2023-09-02)

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.