SAB2104153

Anti-ZFR antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-FLJ41312
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 117 kDa
• Reattività contro le specie: bovine, rat, mouse, horse, human, rabbit, dog
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NM_016107
• N° accesso UniProt: Q96KR1
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ZFR(51663)

Descrizione

Descrizione generale

Zinc finger RNA binding protein (ZFR) is a highly conserved protein and is homologous to mouse ZFR. It is essential in the early developmental stages. ZFR has three N-terminal C2H2 zinc finger motifs and a C-terminal DZF (domain associated with zinc fingers) domain. ZFR is highly expressed in brain, whereas skeletal muscles is devoid of ZFR expression. In human chromosome, the gene ZFR is localized on 5p13.3.

Immunogeno

Synthetic peptide directed towards the middle region of human ZFR

Applicazioni

Anti-ZFR antibody produced in rabbit has been used in western blot analysis.

Azioni biochim/fisiol

Zinc finger RNA binding protein (ZFR) binds to RNA and DNA and promotes DNA repair and chromosome organisation. ZFR regulates alternative pre-mRNA splicing and suppress interferon 1 expression in tissues. ZFR is a key factor in regulating transcription in macrophages. ZFR is critical for Staufen 2 isoform specific nucleocytoplasmic shuttling in neurons. ZFR is a potent marker and therapeutic target in cancer. ZFR is highly expressed in pancreatic cancer and knockdown of which suppressed the tumor cell growth and proliferation. ZFR is overexpressed in non-small-cell lung carcinoma (NSCLC) and causes cell growth and metastasis.

Sequenza

Synthetic peptide located within the following region: RQIHKVLGMDPLPQMSQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKDYDN

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable