Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

SAB2100078

Sigma-Aldrich

Anti-AHRR antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-AHH, Anti-AHHR, Anti-Aryl-hydrocarbon receptor repressor, Anti-KIAA1234, Anti-MGC167813

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 403.00

CHF 403.00


Spedizione prevista il29 aprile 2025



Scegli un formato

Cambia visualizzazione
100 μL
CHF 403.00

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

CHF 403.00


Spedizione prevista il29 aprile 2025


Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

78 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... AHRR(57491)

Categorie correlate

Immunogeno

Synthetic peptide directed towards the middle region of human AHRR

Azioni biochim/fisiol

Dioxin is a teratogen that exerts its effects through the arylhydrocarbon receptor in conjunction with the receptor′s binding partner, arylhydrocarbon receptor nuclear translocator. AHRR represses signal transduction by the arylhydrocarbon receptor by competing with the arylhydrocarbon receptor nuclear translocator for binding to the arylhydrocarbon receptor. Expression of the repressor is stimulated by the receptor/translocator heterodimer, thereby regulating receptor function through a negative feedback mechanism. In addition, AHRR can bind to nuclear factor kappa-B.Dioxin is a teratogen that exerts its effects through the arylhydrocarbon receptor in conjunction with the receptor′s binding partner, arylhydrocarbon receptor nuclear translocator. The protein encoded by this gene represses signal transduction by the arylhydrocarbon receptor by competing with the arylhydrocarbon receptor nuclear translocator for binding to the arylhydrocarbon receptor. Expression of the repressor is stimulated by the receptor/translocator heterodimer, thereby regulating receptor function through a negative feedback mechanism. In addition, the encoded protein can bind to nuclear factor kappa-B. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequenza

Synthetic peptide located within the following region: LPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVP

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.