SAB1412598

ANTI-MUC2 antibody produced in mouse

clone 2A9, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: MLP, MUC2, SMUC
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2A9, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen 35.09 kDa
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; indirect immunofluorescence: suitable
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_002457
• N° accesso UniProt: Q02817
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MUC2(4583)

Descrizione

Descrizione generale

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. (provided by RefSeq)

Immunogeno

MUC2 (NP_002448, 4993 a.a. ~ 5078 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
THCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTV

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable