SAB1406878

Anti-KIAA0101 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: L5, NS5ATP9, OEATC-1, OEATC1, PAF, p15(PAF)
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: antigen ~12.32 kDa
• Reattività contro le specie: human
• tecniche: immunofluorescence: suitable; western blot: 1 μg/mL
• N° accesso NCBI: NM_014736.4
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... KIAA0101(9768)

Descrizione

Descrizione generale

KIAA0101, also known as, proliferating cell nuclear antigen (PCNA) clamp associated factor (PCLAF), is a proliferating cell nuclear antigen-associated factor. It is a 15kDa protein. It is highly expressed in thymus and colon. KIAA0101 gene is located on the human chromosome 15q22.31.

Immunogeno

KIAA0101 (NP_055551.1, 1 a.a. ~ 111 a.a) full-length human protein.

Sequence
MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

Azioni biochim/fisiol

KIAA0101, also known as, proliferating cell nuclear antigen (PCNA) clamp associated factor (PCLAF), helps in regulating DNA repair, cell cycle progression and cell proliferation. Overexpression of KIAA0101 inhibits UV-induced cell death. It is also used as a prognostic marker for hepatocellular carcinoma(HCC). Overexpression of KIAA0101 acts as a marker for adrenocortical carcinoma (ACC) and human gastric cancer.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable