SAB1405974

Anti-HTN1 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: HIS1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: antigen ~7 kDa
• Reattività contro le specie: human
• tecniche: western blot: 1 μg/mL
• N° accesso NCBI: NM_002159.2
• N° accesso UniProt: P15515
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... HTN1(3346)

Descrizione

Descrizione generale

Histatin 1 (HTN1) is a histidine-rich phosphoprotein.HTN1 functions as an antimicrobial peptide with 38 amino acids. It is highly enriched in human saliva. HTN1 gene is located on human chromosome 4q13.3.

Immunogeno

HTN1 (NP_002150.1, 1 a.a. ~ 57 a.a) full-length human protein.

Sequence
MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN

Azioni biochim/fisiol

Histatin 1 (HTN1) promotes migration of oral keratinocytes and fibroblasts in vitro. It also contributes to endothelial cell adhesion, migration and angiogenesis. HTN1 helps in oral wound healing. HTN1 is used as a marker for human lacrimal epithelium in accessory lacrimal gland (ALG) and cadaveric main lacrimal gland (MLG). HTN1 also has candidacidal activity and helps in mineralization by adsorbing to hydroxyapatite.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable