SAB1404792

Monoclonal Anti-RBM6, (C-terminal) antibody produced in mouse

clone 4B3, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: 3G2, DEF-3, DEF3, DKFZp686B0877, FLJ36517, HLC-11, NY-LU-12, g16
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: 4B3, monoclonal
• Application: ELISA (c), ELISA (i), WB
• Citations: 3

Proprietà

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4B3, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable, indirect ELISA: suitable, western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_005777
• UniProt accession no.: P78332
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RBM6(10180)

Descrizione

General description

Mouse monoclonal antibody raised against a partial recombinant RBM6. RNA binding motif protein 6 (RBM6) is expressed in peripheral blood leukocytes, thymus and lymph nodes. The gene encoding it is localized on human chromosome 3p21.3 and has 21 exons.

Immunogen

RBM6 (NP_005768.1, 1024 a.a. ~ 1123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD

Biochem/physiol Actions

RNA binding motif protein 6 (RBM6) associates with RNA. It has been linked to lung cancers.

Physical form

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Classe di stoccaggio: 10 - Combustible liquids
• wgk: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable