SAB1403687

Monoclonal Anti-COX6B1 antibody produced in mouse

clone 2D3, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: COX6B, COXG
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2D3, monoclonal
• Stato: buffered aqueous solution
• PM: antigen ~35.57 kDa
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso NCBI: BC001015
• N° accesso UniProt: P14854
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... COX6B1(1340)

Descrizione

Descrizione generale

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. (provided by RefSeq)

Immunogeno

COX6B1 (AAH01015, 1 a.a. ~ 86 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI

Applicazioni

Monoclonal Anti-COX6B1 antibody produced in mouse is suitable for capture ELISA, indirect ELISA and western blot applications.

Azioni biochim/fisiol

COX6B1 (cytochrome c oxidase subunit VIb polypeptide 1) is involved in the regulation of mitochondrial biogenesis. Itis involved in the transport of electron from reduced cytochrome C to molecular oxygen. In muscles, COX gene consists of striated muscle-specific regulatory motifs such as E-box, CArG, and MEF2 at the proximal promoter regions. The large hydrophobic catalytic subunit acts in the electron transfer whereas the small unit is responsible for regulation and assembly of the complex. In mammals, it exists as a monomer with 13 subunits but in the active state serves as a dimer in vivo. Deficiency of COX6B1 causes mitochondrial diseases such as encephalomyopathy, hydrocephalus and hypertropic cardiomyopathy.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable