SAB1403423

Monoclonal Anti-SCGB3A1 antibody produced in mouse

clone 3G5, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: HIN-1, HIN1, LU105, MGC87867, PnSP-2, UGRP2
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 3G5, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen ~37.55 kDa
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• N° accesso NCBI: BC029176
• N° accesso UniProt: Q96QR1
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SCGB3A1(92304)

Descrizione

Descrizione generale

Secretoglobin family 3A member 1 (SCGB3A1) is a member of secretoglobin gene super family, which contains small secretory proteins. SCGB3A1 is expressed mainly in the epithelial organs, such as the lungs, breast glands, trachea, prostate and salivary glands. SCGB3A1 gene is located on human chromosome 5q35.3.

Immunogeno

SCGB3A1 (AAH29176, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG

Azioni biochim/fisiol

Secretoglobin family 3A member 1 (SCGB3A1) plays an important role in cell growth, migration and invasion as a potent inhibitor and these activities are mediated through protein kinase B (PKB/AKT) signal pathway. Aberrant mutations of SCGB3A1 may be used as a prognostic marker for breast cancer and other human malignancies. SCGB3A1 is used as an epigenetic marker for therapy selection in glioblastoma multiforme (GBM). SCGB3A1 plays an important role in inflammation.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable