Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

SAB1403056

Sigma-Aldrich

Monoclonal Anti-FLOT1 antibody produced in mouse

clone 4A1, ascites fluid

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

ascites fluid

Tipo di anticorpo

primary antibodies

Clone

4A1, monoclonal

PM

antigen ~37.11 kDa

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgMκ

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... FLOT1(10211)

Descrizione generale

Flotillin 1 (FLOT1) is an integral membrane protein and a component of lipid rafts. This estrogen responsive gene is localized on human chromosome 6p21.33.

Immunogeno

FLOT1 (NP_005794.1, 126 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDI

Azioni biochim/fisiol

Flotillin 1 (FLOT1) has a role in endocytosis. It also functions in growth factor signaling and activates mitogen-activated protein kinase signaling. The protein has been associated with tumor progression and is expressed in many cancers.

Stato fisico

Clear solution

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

13 - Non Combustible Solids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Flotillin-1 protein is upregulated in human endometrial cancer and localization shifts from epithelial to stromal with increasing tumor grade.
Winship AL
Cancer Investigation (2016)
Upregulation of flotillin-1 promotes invasion and metastasis by activating TGF-? signaling in nasopharyngeal carcinoma.
Cao S
Oncotarget (2016)
Integrative analysis for finding genes and networks involved in diabetes and other complex diseases
Regine Bergholdt
Genome Biology (2007)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.