SAB1402456

Monoclonal Anti-OSMR antibody produced in mouse

clone 3E12, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: MGC150626, MGC150627, MGC75127, OSMRB
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 3E12, monoclonal
• Stato: buffered aqueous solution
• PM: antigen ~37.11 kDa
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2bκ
• N° accesso NCBI: NM_003999
• N° accesso UniProt: Q99650
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... OSMR(9180)

Descrizione

Descrizione generale

Oncostatin M receptor (OSMR) is a cell surface cytokine receptor. Oncostatin M and interleukin-31 are its ligands. The gene encoding this protein is localized on human chromosome 5p.

Immunogeno

OSMR (NP_003990.1, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEP

Azioni biochim/fisiol

Oncostatin M receptor (OSMR) acts as an activator of janus kinase/signal transducers and activators of transcription (JAK/STAT) and mitogen-activated protein kinase pathway. Thus, it has a role in stimulating cytokines and inflammatory substances. Mutation in the OSMR gene has been linked to primary localized cutaneous amyloidosis.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable