Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

SAB1402228

Sigma-Aldrich

Monoclonal Anti-HOXA6 antibody produced in mouse

clone 3A6, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

HOX1, HOX1.2, HOX1B

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μG
CHF 474.00

CHF 474.00


Spedizione prevista il17 aprile 2025



Scegli un formato

Cambia visualizzazione
100 μG
CHF 474.00

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

CHF 474.00


Spedizione prevista il17 aprile 2025


Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

3A6, monoclonal

Stato

buffered aqueous solution

PM

antigen ~37.11 kDa

Reattività contro le specie

human

tecniche

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... HOXA6(3203)

Descrizione generale

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. (provided by RefSeq)

Immunogeno

HOXA6 (NP_076919, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADR

Azioni biochim/fisiol

The members of HOX (Homeobox) gene family clusters with each other to form a complex. In HOXA6 (homeobox A6), there are eight homeoboxes of 90kb DNA in the cluster. It is expressed in the human adult small intestinal mucosa. It acts as transcription factors in defining gradients of cellular differentiation. It mainly functions in hemopoietic progenitor cell development, embryonic and fetal development.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Glenda J Dickson et al.
Experimental hematology, 37(3), 322-333 (2009-01-23)
Hemopoietic progenitor cells express clustered homeobox (Hox) genes in a pattern characteristic of their lineage and stage of differentiation. In general, HOX expression tends to be higher in more primitive and lower in lineage-committed cells. These trends have led to
D Acampora et al.
Nucleic acids research, 17(24), 10385-10402 (1989-12-25)
We report the identification of 10 new human homeobox sequences. Altogether, we have isolated and sequenced 30 human homeoboxes clustered in 4 chromosomal regions called HOX loci. HOX1 includes 8 homeoboxes in 90 kb of DNA on chromosome 7. HOX2
E Boncinelli et al.
Genome, 31(2), 745-756 (1989-01-01)
We report the genomic organization of 20 human class I homeoboxes and the predicted primary sequence of the encoded homeodomains. These homeoboxes are clustered in four complex HOX loci on chromosomes 2, 7, 12, and 17. The homeoboxes of one
D Duboule et al.
The EMBO journal, 8(5), 1497-1505 (1989-05-01)
This paper reports the cloning of the fourth major murine homeogene complex, HOX-5. The partial characterization of this gene cluster revealed the presence of two novel genes (Hox-5.2, Hox-5.3) located at the 5' extremity of this complex. In situ hybridization
J R Walters et al.
Gastroenterology, 113(2), 472-477 (1997-08-01)
Different digestive enzymes and transporters are present in the duodenum, jejunum, and ileum, but the factors determining region-specific gene expression are not yet understood. Homeobox transcription factors are important in defining gradients of cellular differentiation. The aim of this study

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.