MSST0044

SILu^™Lite TIMP1, Metalloproteinase inhibitor 1 human

recombinant, expressed in HEK 293 cells, MS Protein Standard

• Codice UNSPSC: 23201100
• NACRES: NA.12

Proprietà

• Ricombinante: expressed in HEK 293 cells
• Livello qualitativo: 200
• Saggio: ≥98% (SDS-PAGE)
• Forma fisica: lyophilized powder
• Compatibilità: suitable for mass spectrometry (internal calibrator)
• N° accesso UniProt: P01033
• Temperatura di conservazione: −20°C

Descrizione

Descrizione generale

SILu^™Lite TIMP1 is a recombinant human protein expressed in human 293 cells. It consists of 184 amino acids, with a calculated molecular mass of 20.7 kDa. SILu^™Lite TIMP1 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Azioni biochim/fisiol

TIMP-1 is glycoprotein that is over-expressed in the supernatant of tissue extracts of breast, gastric, colorectal, and hepatocellular carcinomas. It belongs to the family of “tissue inhibitors of metalloproteinases,” a group of proteins that help regulate bone turnover. TIMP-1 serum levels are significantly associated with HER2 extracellular domain (ECD)-positivity and poorer disease-free survival among primary breast cancer patients with HER2 overexpression. High levels of serum TIMP-1 correlate with advanced disease and predict for poor survival in patients with multiple myeloma treated with bortezomib and/or IMiDs during their disease course.

Sequenza

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Stato fisico

Supplied as a lyophilized powder containing phosphate buffered saline.

Note legali

SILu is a trademark of Sigma-Aldrich Co. LLC

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 11 - Combustible Solids
• Classe di pericolosità dell'acqua (WGK): WGK 2
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable