This product is a mixture of 22 peptides derived from the post-trypsin digest of QCAL. This is a lyophilized powder. Upon reconstitution with an appropriate solvent - typically 0.1% formic or trifluoroacetic acid in water - the solution is injection-ready. Please see the link below to review the product technical bulletin for further instructions for use:
https://www.sigmaaldrich.com/deepweb/assets/sigmaaldrich/product/documents/827/937/msqc2dat.pdf
MSQC2
MS QCAL Peptide Mix
lyophilized powder
Sinonimo/i:
MS Qual/Quant QC Mix, universal MS platform standard
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Scegli un formato
Cambia visualizzazione
2 X 25 μG
CHF 339.00
About This Item
Codice UNSPSC:
12352200
NACRES:
NA.24
Prodotti consigliati
Stato
lyophilized powder
Classi chimiche degli analiti
amino acids, peptides, proteins
tecniche
HPLC: suitable
applicazioni
food and beverages
Formato
multi-component solution
Condizioni di spedizione
ambient
Temperatura di conservazione
2-8°C
Cerchi prodotti simili? Visita Guida al confronto tra prodotti
Descrizione generale
QCAL was designed using the QconCAT technology and recombinantly expressed in E. coli. The parent protein sequence of QCAL is as follows:
MGALRVFDEFKPLVEEPQNLIRVFDEFKPLVKPEEPQNLIRVFDEFKPLVKPEEKPQNLIRVFDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIKPRVFDEFQPLVEEPQNLIRGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGVNDNEEGFFSAKGGGVNDNEEGFFSARAVMDDFAAFVEKAVMMDDFAAFVEKAVMMMDDFAAFVEKGLVKFVVPRALELFRIGDYAGIKEALDFFARYLGYLEQLLRVLYPNDNFFEGKLFTFHADICTLPDTEKALVALVLVPRGSLEVLFQGPIEGRTENLYFQGDDDDKALVALVHHHHHH
QCAL was subsequently digested with trypsin to give a core mixture of 22 peptides.
MGALRVFDEFKPLVEEPQNLIRVFDEFKPLVKPEEPQNLIRVFDEFKPLVKPEEKPQNLIRVFDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIKPRVFDEFQPLVEEPQNLIRGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGVNDNEEGFFSAKGGGVNDNEEGFFSARAVMDDFAAFVEKAVMMDDFAAFVEKAVMMMDDFAAFVEKGLVKFVVPRALELFRIGDYAGIKEALDFFARYLGYLEQLLRVLYPNDNFFEGKLFTFHADICTLPDTEKALVALVLVPRGSLEVLFQGPIEGRTENLYFQGDDDDKALVALVHHHHHH
QCAL was subsequently digested with trypsin to give a core mixture of 22 peptides.
Applicazioni
MSQC2 is intended to act as a universal MS platform standard, by providing several elements for calibration and performance assessment, such as instrument resolution and linearity of signal detection.
This product is optimized to assess platform characteristics, including:
- Repeatability/Reproducibility between runs
- System stability (drift, chromatography, signal intensity, sensitivity, etc.)
- Inter- and intra- platform and lab comparisons
Caratteristiche e vantaggi
General
Complexity
Complexity
- Defined mixture gives confidence in your instruments analysis
Componenti
Each vial contains 25 μg of lyophilized peptides that are derived from trypsin digestion of the protein concatamer QCAL.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 1
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
I clienti hanno visto anche
Claire E Eyers et al.
Journal of the American Society for Mass Spectrometry, 19(9), 1275-1280 (2008-07-05)
If proteome datasets are to be collated, shared, and merged for higher level proteome analyses, there is a need for generally accepted strategies and reagents for optimization and standardization of instrument performance. At present, there is no single protein or
Julie M Pratt et al.
Nature protocols, 1(2), 1029-1043 (2007-04-05)
An important area of proteomics involves the need for quantification, whether relative or absolute. Many methods now exist for relative quantification, but to support biomarker proteomics and systems biology, absolute quantification rather than relative quantification is required. Absolute quantification usually
-
1. I would like to clarify whether this peptide quantity is based on the mass of the E.coli protein before trypsinization. 2. Is this product LC-MS injection-ready? 3. Please provide the protocol for this product.
1 answer-
Helpful?
-
Active Filters
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.
