Passa al contenuto
Merck
Tutte le immagini(2)

Documenti

HPA051171

Sigma-Aldrich

Anti-FKBP10 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-FK506 binding protein 10, 65 kDa, Anti-FKBP6, Anti-FLJ20683, Anti-FLJ22041, Anti-FLJ23833, Anti-hFKBP65

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(2)

About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
HPA051171
NACRES:
NA.43

Origine biologica

rabbit

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Forma fisica

buffered aqueous glycerol solution

Reattività contro le specie

human

tecniche

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

Sequenza immunogenica

CSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSRED

N° accesso UniProt

Q96AY3

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... FKBP10(60681)

Descrizione generale

FK506 binding protein 10 (FKBP10) is expressed in the endoplasmic reticulum. It is a peptidyl-prolyl cis-trans isomerase, with a molecular weight of 65kDa. The gene encoding this protein is localized on human chromosome 17q21.2.

Immunogeno

FK506 binding protein 10, 65 kDa recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-FKBP10 antibody produced in rabbit has been used in immunohistochemistry.

Azioni biochim/fisiol

FK506 binding protein 10 (FKBP10) is a chaperone protein. It is thought to be a chaperone of type I collagen. Mutations in the FKBP10 gene have been linked to Bruck syndrome, which is characterized by bone fragility and congenital joint contractures.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85546

Stato fisico

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Osama H Essawi et al.
European journal of medical genetics, 63(9), 103980-103980 (2020-06-13)
To date 45 autosomal recessive disease-causing variants are reported in the FKBP10 gene. Those variant were found to be associated with Osteogenesis Imperfecta (OI) for which the hallmark phenotype is bone fractuers or Bruck Syndrome (BS) where bone fractures are
Bruck syndrome - a rare syndrome of bone fragility and joint contracture and novel homozygous FKBP10 mutation.
Moravej H, et. Al
Endokrynologia Polska, 66(2), 170-174 (2015)
Integration of zebrafish fin regeneration genes with expression data of human tumors in silico uncovers potential novel melanoma markers
Martin Hagedorn
Oncotarget, 7(44), 71567?71579-71567?71579 (2016)
Kuskokwim syndrome, a recessive congenital contracture disorder, extends the phenotype of FKBP10 mutations
Aileen M. Barnes
Human Mutation, 34(9), 1279?1288-1279?1288 (2013)
Michael C J Quinn et al.
International journal of oncology, 42(3), 912-920 (2013-01-29)
The frequent loss of chromosome 17 in epithelial ovarian carcinomas (EOC), particularly high-grade serous carcinomas (HGSC), has been attributed to the disruption of TP53 (at 17p13.1) and other chromosome 17 genes suspected to play a role in tumour suppressor pathways.

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.