HPA043083

Anti-PLA2G4C antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-Cpla2-γ, Anti-Phospholipase a2, group ivc (cytosolic, calcium-independent)
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA043083
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Stato: buffered aqueous glycerol solution
• Reattività contro le specie: human
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• Sequenza immunogenica: EAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKD
• N° accesso UniProt: Q9UP65
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PLA2G4C(8605)

Descrizione

Descrizione generale

The gene PLA2G4C (phospholipase A2 group IVC) is mapped to human chromosome 19. The encoded protein belongs to the phospholipase A2 family of proteins. PLA2G4C is mainly expressed in the brain, heart and skeletal muscle. The protein is present in the endoplasmatic reticulum and mitochondria.

Immunogeno

phospholipase A2, group IVC (cytosolic, calcium-independent) recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-PLA2G4C antibody produced in rabbit has been used in western blotting, immunofluorescence and immunoprecipitation.

Azioni biochim/fisiol

PLA2G4C (phospholipase A2 group IVC) is responsible for the release of fatty acids from phospholipids. It plays an important role in the generation of prostaglandins and remodeling of cellular membrane. Cytoplasmic PLA2G4C participates in arachidonic acid metabolism. PLA2G4C also exhibits lysophospholipase and transacylation activity. Mutation in this gene, rs1549637 (T>A), might be associated with the susceptibility to schizophrenia. Polymorphism in this gene controls the disease outcome in patients with colorectal cancer. It is also involved in the chemotaxis of breast cancer cells. Silencing of this gene suppresses EGF (epidermal growth factor)-mediated chemotaxis in breast cancer cell lines. PLA2G4C variants can increase the levels of prostaglandins, thereby influencing preterm birth risk.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST82579

Stato fisico

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1