HPA029046

Anti-PPP2R5D antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab2

• Sinonimo/i: Anti-B56D, Anti-protein phosphatase 2, regulatory subunit B′, δ isoform
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA029046
• NACRES: NA.43

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human, rat, mouse
• Convalida avanzata: independent; Learn more about Antibody Enhanced Validation
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• Sequenza immunogenica: PKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPAL
• N° accesso UniProt: Q14738
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PPP2R5D(5528)

Descrizione

Descrizione generale

PPP2R5D (protein phosphatase 2 regulatory subunit B′ δ) is a member of the largest PP2A B′ (Protein phosphatase 2A) (B56) subunit family. It codes for B56δ, a 602 amino acid protein, that is a regulatory subunit B of PP2A. In human and mouse, it is more expressed in the progressing brain and less in heart and skeletal muscles.

Immunogeno

protein phosphatase 2, regulatory subunit B', delta isoform recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Azioni biochim/fisiol

PPP2R5D (protein phosphatase 2 regulatory subunit B′ δ) plays a major role in modulating neuronal and developmental regulation processes such as PI3K (phosphoinositide 3-kinase) /AKT (AKT serine/threonine kinase) and GSK3β (glycogen synthase kinase 3 β) mediated cell growth, chromatin remodeling and gene transcriptional regulation. It also play a vital role in the modulation of Cdc25C (cell division cycle 25C) and Cdk1 (cyclin dependent kinase 1), controlling exit from mitosis. It even controls the dephosphorylation of DARPP-32 (dopamine- and cAMP-regulated phosphoprotein, 32kd; PPP1R1B), thereby modulating the dopaminergic neurotransmission in neurons. Mutations in the PP2A regulatory subunit can cause human overgrowth.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST77387

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable