HPA025703

Anti-BLZF1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

• Sinonimo/i: Anti-Basic leucine zipper nuclear factor 1, Anti-Golgin-45, Anti-JEM-1, Anti-p45 basic leucine-zipper nuclear factor
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA025703
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: recombinant expression; Learn more about Antibody Enhanced Validation
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• Sequenza immunogenica: KSLGHHKGEFLGQSEGVIEPNKELSEVKNVLEKLKNSERRLLQDKEGLSNQLRVQTEVNRELKKLLVASVGDDLQYHFERLARE
• N° accesso UniProt: Q9H2G9
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... BLZF1(8548)

Descrizione

Descrizione generale

The gene BLZF1 (basic leucine zipper nuclear factor 1) is mapped to human chromosome 1q24. It belongs to the b-ZIP family of proteins. The encoded protein has a PEST (proline [P], glutamic acid [E], serine [S], and threonine [T]) motif, a putative leucine repeat and several phosphorylation sites. This protein is present in the nucleus, cytoplasm and Golgi apparatus.

Immunogeno

Golgin-45 recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Azioni biochim/fisiol

BLZF1 (basic leucine zipper nuclear factor 1) might work as a transcription factor. It is involved in epigenetic regulation by binding to DNMT3L (DNA methyltransferase 3 like) and also participates in Wnt/β-catenin signaling. The BLZF1 gene is downregulated in acute promyelocytic leukemia (APL) cell line NB4. On the other hand, it is upregulated in presence of dengue virus infection. BLZF1 also interacts with GRASP55 (the medial-Golgi matrix protein) and the GTP form of rab2. It is involved in the secretory protein transport and maintenance of the Golgi structure. This gene is downregulated in hepatocellular carcinoma. This low expression is associated with poor overall survival.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST76646

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable