HPA023861

Anti-AFMID antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

• Sinonimo/i: Anti-KF, Anti-Kynurenine formamidase, Anti-Probable arylformamidase
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA023861
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: recombinant expression; Learn more about Antibody Enhanced Validation
• tecniche: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Sequenza immunogenica: VSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD
• N° accesso UniProt: Q63HM1
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... AFMID(125061)

Descrizione

Descrizione generale

AFMID, kynurenine formamidase also called arylformamidase, is located on human chromosome 17q25.3. AFMID catalyses the hydrolysis of NFK (N-formyl-L-kynurenine) to kynurenine.

Immunogeno

Probable arylformamidase recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-AFMID antibody produced in rabbit may be used for the detection of AFMID protein in western blotting.

Azioni biochim/fisiol

The conversion of tryptophan to nicotinic acid is catalysed by kynurenine formamidase. Alternative splicing in kynurenine formamidase gene modulates tumor suppressor p53 role in hepatocellular carcinoma development and progression. Indoleamine 2,3-dioxygenase-mediated kynurenine formation could play a role in cataract formation related to chronic inflammation.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST75936

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable