HPA023371

Anti-DCXR antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

• Sinonimo/i: Anti-Carbonyl reductase II, Anti-Dicarbonyl/L-xylulose reductase, Anti-Kidney dicarbonyl reductase, Anti-L-xylulose reductase, Anti-Sperm surface protein P34H, Anti-XR, Anti-kiDCR
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA023371
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Stato: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:500-1:1000
• Sequenza immunogenica: IRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEG
• N° accesso UniProt: Q7Z4W1
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... DCXR(51181)

Descrizione

Descrizione generale

Dicarbonyl/L-xylulose reductase, kidney dicarbonyl reductase, sperm surface protein P34H (DCXR, DCR) is an uronate cycle of glucose metabolism NADPH-linked reductase that catalyzes α-dicarbonyl and l-xylulose. DCXR is highly expressed in kidney proximal renal tubule inner membranes. DCXR/P34H is also found on the acrosomal cap of epididymal sperm and is considered to be a marker of sperm maturation.

Rabbit polyclonal DCXR antibody reacts with human dicarbonyl/L-xylulose reductase, kidney dicarbonyl reductase, sperm surface protein P34H.

Immunogeno

L-xylulose reductase recombinant protein epitope signature tag (PrEST)

Applicazioni

Rabbit polyclonal DCXR antibody is used to tag dicarbonyl/L-xylulose reductase for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of dicarbonyl/L-xylulose reductase in uronate cycle metabolism, and kidney and sperm function.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST75801

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable